Annotations

Type Name Description Pathways
Gene Code
rimP
Gene Product
ribosome maturation factor RimP
Ortholog
N0.HOG0001210 ribosome maturation factor RimP
KEGG gene
K09748 rimP; ribosome maturation factor RimP
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:0071944 cell periphery
Gene Ontology
GO:0071840 cellular component organization or biogenesis
Gene Ontology
GO:0071826 ribonucleoprotein complex subunit organization
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0070925 organelle assembly
Gene Ontology
GO:0065003 protein-containing complex assembly
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044444 obsolete cytoplasmic part
Gene Ontology
GO:0044424 obsolete intracellular part
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044267 cellular protein metabolic process
Gene Ontology
GO:0044260 cellular macromolecule metabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0044085 cellular component biogenesis
Gene Ontology
GO:0043933 protein-containing complex subunit organization
Gene Ontology
GO:0043604 amide biosynthetic process
Gene Ontology
GO:0043603 cellular amide metabolic process
Gene Ontology
GO:0043170 macromolecule metabolic process
Gene Ontology
GO:0043043 peptide biosynthetic process
Gene Ontology
GO:0042274 ribosomal small subunit biogenesis
Gene Ontology
GO:0042255 ribosome assembly
Gene Ontology
GO:0042254 ribosome biogenesis
Gene Ontology
GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0034622 cellular protein-containing complex assembly
Gene Ontology
GO:0022618 ribonucleoprotein complex assembly
Gene Ontology
GO:0022613 ribonucleoprotein complex biogenesis
Gene Ontology
GO:0022607 cellular component assembly
Gene Ontology
GO:0019538 protein metabolic process
Gene Ontology
GO:0016043 cellular component organization
Gene Ontology
GO:0016020 membrane
Gene Ontology
GO:0010467 gene expression
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009059 macromolecule biosynthetic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006996 organelle organization
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006518 peptide metabolic process
Gene Ontology
GO:0006412 translation
Gene Ontology
GO:0005886 plasma membrane
Gene Ontology
GO:0005829 cytosol
Gene Ontology
GO:0005737 cytoplasm
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005622 intracellular anatomical structure
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0000028 ribosomal small subunit assembly
Eggnog Protein
EP:rimP
Eggnog Ortholog
EO:1V6KT
Eggnog Description
ED:Required for maturation of 30S ribosomal subunits

Sequences

Nucleotide sequence (GC-content: 50.4 %):

ATGAGTAATAAGACTGTAGTCGAGACCGTAACGGCGCTGGTGGAACCAATCTTAGCTGAACACAACTTTGAACTGTACGAAGTTGAATTCGTCCAGGAAGCCAAGAGCTGGTATTTGCGGGTCTACATCGATAAGGAAGGCGGCATCACGCTGGAAGATTGTGCCCTTGTCAGCGACCAGTTGAGCGAACAACTGGACAGCGCCGATCCAGACCCGATCCCCCAGGCCTACTTCTTGGAAGTTTCTTCGCCAGGGGCTGAACGGCCGCTGAAAAAAGAAGTGGACTACCAACGGGCCCTTGACCAATACGTGAACGTTTCTTTGTACCAACAAATTGACGGCCACAAGGTGTTTGAAGGGTATCTTCGCCAATTGAGCCCGGATGAGTTAACCATTGAGTACATGGATAAAACCCGCCAAAAGCAGGTTGTAATCCCGCGGGACAAGGTTGCCAAGGCCCGCTTAGCGATTAAGTTTTAA

Protein sequence:

MSNKTVVETVTALVEPILAEHNFELYEVEFVQEAKSWYLRVYIDKEGGITLEDCALVSDQLSEQLDSADPDPIPQAYFLEVSSPGAERPLKKEVDYQRALDQYVNVSLYQQIDGHKVFEGYLRQLSPDELTIEYMDKTRQKQVVIPRDKVAKARLAIKF

GenBank Info

gene - rimP
locus_tag - FAM19471-i1-1.1_000852
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003681934.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - ribosome maturation factor RimP
protein_id - extdb:FAM19471-i1-1.1_000852

Gene locus (click to toggle display options) expand

Located on scaffold FAM19471-i1-1_scf0012

Update range to 10000 bp

Cellular location expand

Responsible annotations:
SL-0162: GO:0016020 membrane
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0039: GO:0005886 plasma membrane
SL-0091: GO:0005829 cytosol

FAM19471-i1-1.1_000851
FAM19471-i1-1.1_000853