locus tag: FAM19038-p1-1.1_002661 genome: FAM19038-p1-1.1
species: Acidipropionibacterium thoenii DSM 20276 taxid: 1122998

Annotations

Type Name Description Pathways
Gene Code
 rpmA
Ortholog
 N0.HOG0000875 50S ribosomal protein L27
KEGG gene
 K02899 RP-L27, MRPL27, rpmA; large subunit ribosomal protein L27 kornec03010
Gene Ontology
 GO:1990904 ribonucleoprotein complex
Gene Ontology
 GO:1902626 assembly of large subunit precursor of preribosome
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:0090070 positive regulation of ribosome biogenesis
Gene Ontology
 GO:0090069 regulation of ribosome biogenesis
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0071840 cellular component organization or biogenesis
Gene Ontology
 GO:0071826 ribonucleoprotein complex subunit organization
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0070925 organelle assembly
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0065003 protein-containing complex assembly
Gene Ontology
 GO:0051128 regulation of cellular component organization
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0048518 positive regulation of biological process
Gene Ontology
 GO:0044877 protein-containing complex binding
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044446 obsolete intracellular organelle part
Gene Ontology
 GO:0044445 obsolete cytosolic part
Gene Ontology
 GO:0044444 obsolete cytoplasmic part
Gene Ontology
 GO:0044424 obsolete intracellular part
Gene Ontology
 GO:0044422 obsolete organelle part
Gene Ontology
 GO:0044391 ribosomal subunit
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044267 cellular protein metabolic process
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0044089 positive regulation of cellular component biogenesis
Gene Ontology
 GO:0044087 regulation of cellular component biogenesis
Gene Ontology
 GO:0044085 cellular component biogenesis
Gene Ontology
 GO:0043933 protein-containing complex subunit organization
Gene Ontology
 GO:0043604 amide biosynthetic process
Gene Ontology
 GO:0043603 cellular amide metabolic process
Gene Ontology
 GO:0043232 intracellular non-membrane-bounded organelle
Gene Ontology
 GO:0043229 intracellular organelle
Gene Ontology
 GO:0043228 non-membrane-bounded organelle
Gene Ontology
 GO:0043226 organelle
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0043043 peptide biosynthetic process
Gene Ontology
 GO:0043022 ribosome binding
Gene Ontology
 GO:0043021 ribonucleoprotein complex binding
Gene Ontology
 GO:0042273 ribosomal large subunit biogenesis
Gene Ontology
 GO:0042256 mature ribosome assembly
Gene Ontology
 GO:0042255 ribosome assembly
Gene Ontology
 GO:0042254 ribosome biogenesis
Gene Ontology
 GO:0040008 regulation of growth
Gene Ontology
 GO:0040007 growth
Gene Ontology
 GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034622 cellular protein-containing complex assembly
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0030312 external encapsulating structure
Gene Ontology
 GO:0022626 cytosolic ribosome
Gene Ontology
 GO:0022625 cytosolic large ribosomal subunit
Gene Ontology
 GO:0022618 ribonucleoprotein complex assembly
Gene Ontology
 GO:0022613 ribonucleoprotein complex biogenesis
Gene Ontology
 GO:0022607 cellular component assembly
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0016043 cellular component organization
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0015934 large ribosomal subunit
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009059 macromolecule biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006996 organelle organization
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006518 peptide metabolic process
Gene Ontology
 GO:0006412 translation
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005840 ribosome
Gene Ontology
 GO:0005829 cytosol
Gene Ontology
 GO:0005737 cytoplasm
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005622 intracellular anatomical structure
Gene Ontology
 GO:0005618 cell wall
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0005198 structural molecule activity
Gene Ontology
 GO:0003735 structural constituent of ribosome
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0001558 regulation of cell growth
Gene Ontology
 GO:0000027 ribosomal large subunit assembly
Eggnog Protein
 EP:rpmA
Eggnog Ortholog
 EO:2IQDI
Eggnog Description
 ED:Belongs to the bacterial ribosomal protein bL27 family
Gene Product
 50S ribosomal protein L27

Occurs in the following pathway maps:

Pathway Description
kornec03010 Ribosome

Sequences

Nucleotide sequence (GC-content: 69.6 %):

Download Copy to clipboard
ATGGCACACAAGAAGGGCGCATCCTCGTCCCGCAACGGCCGCGACTCCAACGCTCAGCGTCTGGGCGTCAAGCGGTTCGGCGGTCAGCTGGTCAACGCCGGCGAGATCATCATCCGTCAGCGCGGCACCCACTTCCACCCCGGCAAGGGGGTCGGCCGCGGCAAGGATGACACACTGTTCGCGCTGCGCGCCGGCAACGTCGCCTTCGGCAGCCGTCGCGGCCGCCGCGTGATCGACGTCGTTCCGGTCGAGGAGCCCGCTCAGGCCTGA

Protein sequence:

Download Copy to clipboard
MAHKKGASSSRNGRDSNAQRLGVKRFGGQLVNAGEIIIRQRGTHFHPGKGVGRGKDDTLFALRAGNVAFGSRRGRRVIDVVPVEEPAQA

GenBank Info

gene - rpmA
locus_tag - FAM19038-p1-1.1_002661
inference - COORDINATES: similar to AA sequence:RefSeq:WP_002513859.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - 50S ribosomal protein L27
protein_id - extdb:FAM19038-p1-1.1_002661

Gene locus (click to toggle display options) expand

Located on scaffold FAM19038-p1-1_scf0001

Update range to 10000 bp

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall
SL-0162: GO:0016020 membrane
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0039: GO:0005886 plasma membrane
SL-0091: GO:0005829 cytosol
FAM19038-p1-1.1_002660
FAM19038-p1-1.1_002662