Annotations

Type Name Description Pathways
Gene Code
pyrR
Gene Product
bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR
KEGG reaction
R00966 UMP:diphosphate phospho-alpha-D-ribosyltransferase; UMP + Diphosphate <=> Uracil + 5-Phospho-alpha-D-ribose 1-diphosphate kornec01100 kornec00240
Ortholog
N0.HOG0000696 bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR
KEGG gene
K02825 pyrR; pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9] kornec01100 kornec00240
Gene Ontology
GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
GO:1901360 organic cyclic compound metabolic process
Gene Ontology
GO:1901293 nucleoside phosphate biosynthetic process
Gene Ontology
GO:1901137 carbohydrate derivative biosynthetic process
Gene Ontology
GO:1901135 carbohydrate derivative metabolic process
Gene Ontology
GO:0140110 transcription regulator activity
Gene Ontology
GO:0090407 organophosphate biosynthetic process
Gene Ontology
GO:0080090 regulation of primary metabolic process
Gene Ontology
GO:0072528 pyrimidine-containing compound biosynthetic process
Gene Ontology
GO:0072527 pyrimidine-containing compound metabolic process
Gene Ontology
GO:0071944 cell periphery
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0065007 biological regulation
Gene Ontology
GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
GO:0055086 nucleobase-containing small molecule metabolic process
Gene Ontology
GO:0051252 regulation of RNA metabolic process
Gene Ontology
GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
GO:0050794 regulation of cellular process
Gene Ontology
GO:0050789 regulation of biological process
Gene Ontology
GO:0046483 heterocycle metabolic process
Gene Ontology
GO:0046390 ribose phosphate biosynthetic process
Gene Ontology
GO:0044464 obsolete cell part
Gene Ontology
GO:0044281 small molecule metabolic process
Gene Ontology
GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043094 cellular metabolic compound salvage
Gene Ontology
GO:0034654 nucleobase-containing compound biosynthetic process
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
GO:0031323 regulation of cellular metabolic process
Gene Ontology
GO:0030312 external encapsulating structure
Gene Ontology
GO:0019693 ribose phosphate metabolic process
Gene Ontology
GO:0019637 organophosphate metabolic process
Gene Ontology
GO:0019438 aromatic compound biosynthetic process
Gene Ontology
GO:0019222 regulation of metabolic process
Gene Ontology
GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
GO:0018130 heterocycle biosynthetic process
Gene Ontology
GO:0016763 transferase activity, transferring pentosyl groups
Gene Ontology
GO:0016757 transferase activity, transferring glycosyl groups
Gene Ontology
GO:0016740 transferase activity
Gene Ontology
GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
GO:0010468 regulation of gene expression
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009889 regulation of biosynthetic process
Gene Ontology
GO:0009260 ribonucleotide biosynthetic process
Gene Ontology
GO:0009259 ribonucleotide metabolic process
Gene Ontology
GO:0009220 pyrimidine ribonucleotide biosynthetic process
Gene Ontology
GO:0009218 pyrimidine ribonucleotide metabolic process
Gene Ontology
GO:0009165 nucleotide biosynthetic process
Gene Ontology
GO:0009117 nucleotide metabolic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008655 pyrimidine-containing compound salvage
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006796 phosphate-containing compound metabolic process
Gene Ontology
GO:0006793 phosphorus metabolic process
Gene Ontology
GO:0006753 nucleoside phosphate metabolic process
Gene Ontology
GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
GO:0006355 regulation of transcription, DNA-templated
Gene Ontology
GO:0006221 pyrimidine nucleotide biosynthetic process
Gene Ontology
GO:0006220 pyrimidine nucleotide metabolic process
Gene Ontology
GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
GO:0005623 obsolete cell
Gene Ontology
GO:0005618 cell wall
Gene Ontology
GO:0005575 cellular_component
Gene Ontology
GO:0004845 uracil phosphoribosyltransferase activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003700 DNA-binding transcription factor activity
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:pyrR
Eggnog Ortholog
EO:1V3GV
Eggnog Description
ED:Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant
EC Number
EC:2.4.2.9 uracil phosphoribosyltransferase; UMP pyrophosphorylase; UPRTase; UMP:pyrophosphate phosphoribosyltransferase; uridine 5'-phosphate pyrophosphorylase; uridine monophosphate pyrophosphorylase; uridylate pyrophosphorylase; uridylic pyrophosphorylase kornec01100 kornec00240

Occurs in the following pathway maps:

Pathway Description
kornec00240 Pyrimidine metabolism
kornec01100 Metabolic pathways

Sequences

Nucleotide sequence (GC-content: 55.6 %):

GTGGCCCACGAAATTGTGGATGGTTCAAGTATGCAGCGTGCCCTAACCCGGATTACCTACGAAATTATTGAGCAAAACAAGGGGGTCGATAACCTAGTCTTTGTCGGCATTAAGACCCGCGGCGTGTACTTGGCCCAGCGCCTGGCCAAGCGGATGGAACAACTGGAAGGGGTAAAGGTCCCCGTTGGTTCCTTAGATATTACCCTCTACCGTGACGACCGCCACCAGCCGGACCACCACGTTGAGCCCACGGTCAACGCCACCGACGTCGACGTCGATATCAACGATAAGCACGTGATCCTAGTTGACGACGTTTTGTACACCGGGCGGACGGTCCGGGCGGCCTTGGATGCCTTAATGGACCTTGGCCGGCCGAAGCGAATCTCTTTGGCGGTCCTGGTTGACCGTGGTCACCGGGAACTGCCGATTCGCCCTGACTTCGTGGGGAAAAACATCCCGACGTCCAATAGCGAAACGGTTCACGTGGCGGTCGAAGAATACGATGGTCACGAAGACATTTCACTGGAAAACCGTAAATAA

Protein sequence:

MAHEIVDGSSMQRALTRITYEIIEQNKGVDNLVFVGIKTRGVYLAQRLAKRMEQLEGVKVPVGSLDITLYRDDRHQPDHHVEPTVNATDVDVDINDKHVILVDDVLYTGRTVRAALDALMDLGRPKRISLAVLVDRGHRELPIRPDFVGKNIPTSNSETVHVAVEEYDGHEDISLENRK

GenBank Info

gene - pyrR
locus_tag - FAM19471-i1-1.1_001153
EC_number - 2.4.2.9
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003685686.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - bifunctional pyr operon transcriptional regulator/uracil phosphoribosyltransferase PyrR
protein_id - extdb:FAM19471-i1-1.1_001153

Gene locus (click to toggle display options) expand

Located on scaffold FAM19471-i1-1_scf0021

Update range to 10000 bp

Cellular location expand

Responsible annotations:
SL-0041: GO:0005618 cell wall

FAM19471-i1-1.1_001152
FAM19471-i1-1.1_001154