FAM19471-i1-1.1_001142

locus tag: FAM19471-i1-1.1_001142 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type	Name	Description
Gene Code	smpB
Gene Product	SsrA-binding protein SmpB
Ortholog	N0.HOG0000964	SsrA-binding protein SmpB
KEGG gene	K03664	smpB; SsrA-binding protein
Gene Ontology	GO:1901564	organonitrogen compound metabolic process
Gene Ontology	GO:1901363	heterocyclic compound binding
Gene Ontology	GO:0097159	organic cyclic compound binding
Gene Ontology	GO:0071704	organic substance metabolic process
Gene Ontology	GO:0070930	trans-translation-dependent protein tagging
Gene Ontology	GO:0044464	obsolete cell part
Gene Ontology	GO:0044444	obsolete cytoplasmic part
Gene Ontology	GO:0044424	obsolete intracellular part
Gene Ontology	GO:0044267	cellular protein metabolic process
Gene Ontology	GO:0044260	cellular macromolecule metabolic process
Gene Ontology	GO:0044238	primary metabolic process
Gene Ontology	GO:0044237	cellular metabolic process
Gene Ontology	GO:0043412	macromolecule modification
Gene Ontology	GO:0043170	macromolecule metabolic process
Gene Ontology	GO:0036211	protein modification process
Gene Ontology	GO:0019538	protein metabolic process
Gene Ontology	GO:0009987	cellular process
Gene Ontology	GO:0008152	metabolic process
Gene Ontology	GO:0008150	biological_process
Gene Ontology	GO:0006807	nitrogen compound metabolic process
Gene Ontology	GO:0006464	cellular protein modification process
Gene Ontology	GO:0005829	cytosol
Gene Ontology	GO:0005737	cytoplasm
Gene Ontology	GO:0005623	obsolete cell
Gene Ontology	GO:0005622	intracellular anatomical structure
Gene Ontology	GO:0005575	cellular_component
Gene Ontology	GO:0005488	binding
Gene Ontology	GO:0003723	RNA binding
Gene Ontology	GO:0003676	nucleic acid binding
Gene Ontology	GO:0003674	molecular_function
Eggnog Protein	EP:smpB
Eggnog Ortholog	EO:1V3IJ
Eggnog Description	ED:the 2 termini fold to resemble tRNA(Ala) and it encodes a tag peptide

Sequences

Nucleotide sequence (GC-content: 50.2 %):

ATGGCGAAAAAGAACCACCAGGGGCTCGACGCCAACCTGATTGCCCAAAATAAAAAGGCTCGTCATGACTACACGGTTACCGACACCTTTGAAGCCGGGCTCGTTTTAACCGGGACCGAAATCAAGTCGGTGCGTGCACGGCGGGTCACCCTAAAGGATGGCTACGCCCAATTTCATAATGGTGAACTCTGGTTAATGAACGTCCACATTGCCGAATTCGCGGGTGGTAACATCTTTAACCACGACCCGTTACGTAACCGGAAGCTCTTATTGCACAAAAAGGAGCTCAAGAAGTTACAAGGCGAATTAACGGCCAAGGGGGTTACCCTCGTACCGTTAAAAATGTACTTGAAACACGGCTACGCCAAGGTGCTCTTGGGCCTTGCTCAAGGGAAGCACGAGTACGATAAGCGTAACGCCATTAAAAAGCGTGAGCAGGACCGCCAGATTGATCGGGTCATGAAGCATTACTAA

Protein sequence:

MAKKNHQGLDANLIAQNKKARHDYTVTDTFEAGLVLTGTEIKSVRARRVTLKDGYAQFHNGELWLMNVHIAEFAGGNIFNHDPLRNRKLLLHKKELKKLQGELTAKGVTLVPLKMYLKHGYAKVLLGLAQGKHEYDKRNAIKKREQDRQIDRVMKHY

GenBank Info

gene - smpB
locus_tag - FAM19471-i1-1.1_001142
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003666449.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - SsrA-binding protein SmpB
protein_id - extdb:FAM19471-i1-1.1_001142

Gene locus (click to toggle display options)

Located on scaffold FAM19471-i1-1_scf0020

Set range around gene locus Update range to 10000 bp

Render method

Cellular location

Responsible annotations:
SL-0229: GO:0005622 intracellular anatomical structure
SL-0086: GO:0005737 cytoplasm
SL-0091: GO:0005829 cytosol