Annotations

Type Name Description Pathways
Gene Product
bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
Gene Code
argJ
KEGG reaction
R02649 ATP:N-acetyl-L-glutamate 5-phosphotransferase; ATP + N-Acetyl-L-glutamate <=> ADP + N-Acetyl-L-glutamate 5-phosphate kornec01230 kornec01100 kornec00220 kornec01110 kornec01210
KEGG reaction
R02282 N2-Acetyl-L-ornithine:L-glutamate N-acetyltransferase; N-Acetylornithine + L-Glutamate <=> L-Ornithine + N-Acetyl-L-glutamate kornec01230 kornec01100 kornec00220 kornec01210
KEGG reaction
R00259 acetyl-CoA:L-glutamate N-acetyltransferase; Acetyl-CoA + L-Glutamate <=> CoA + N-Acetyl-L-glutamate kornec01230 kornec01100 kornec00220 kornec01110 kornec01210
Ortholog
N0.HOG0001660 bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
KEGG gene
K00930 argB; acetylglutamate kinase [EC:2.7.2.8] kornec01230 kornec01100 kornec00220 kornec01110 kornec01210
KEGG gene
K00620 argJ; glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1] kornec01230 kornec01100 kornec00220 kornec01110 kornec01210
Gene Ontology
GO:1901607 alpha-amino acid biosynthetic process
Gene Ontology
GO:1901605 alpha-amino acid metabolic process
Gene Ontology
GO:1901576 organic substance biosynthetic process
Gene Ontology
GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
GO:1901564 organonitrogen compound metabolic process
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0046394 carboxylic acid biosynthetic process
Gene Ontology
GO:0044283 small molecule biosynthetic process
Gene Ontology
GO:0044281 small molecule metabolic process
Gene Ontology
GO:0044249 cellular biosynthetic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043436 oxoacid metabolic process
Gene Ontology
GO:0019752 carboxylic acid metabolic process
Gene Ontology
GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups
Gene Ontology
GO:0016746 transferase activity, transferring acyl groups
Gene Ontology
GO:0016740 transferase activity
Gene Ontology
GO:0016410 N-acyltransferase activity
Gene Ontology
GO:0016407 acetyltransferase activity
Gene Ontology
GO:0016053 organic acid biosynthetic process
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0009084 glutamine family amino acid biosynthetic process
Gene Ontology
GO:0009064 glutamine family amino acid metabolic process
Gene Ontology
GO:0009058 biosynthetic process
Gene Ontology
GO:0008652 cellular amino acid biosynthetic process
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0008080 N-acetyltransferase activity
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006592 ornithine biosynthetic process
Gene Ontology
GO:0006591 ornithine metabolic process
Gene Ontology
GO:0006526 arginine biosynthetic process
Gene Ontology
GO:0006525 arginine metabolic process
Gene Ontology
GO:0006520 cellular amino acid metabolic process
Gene Ontology
GO:0006082 organic acid metabolic process
Gene Ontology
GO:0004358 glutamate N-acetyltransferase activity
Gene Ontology
GO:0004042 acetyl-CoA:L-glutamate N-acetyltransferase activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:argJ
Eggnog Ortholog
EO:1TPBP
Eggnog Description
ED:Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis the synthesis of N- acetylglutamate from glutamate and acetyl-CoA as the acetyl donor
EC Number
EC:2.7.2.8 acetylglutamate kinase; N-acetylglutamate 5-phosphotransferase; acetylglutamate phosphokinase; N-acetylglutamate phosphokinase; N-acetylglutamate kinase; N-acetylglutamic 5-phosphotransferase kornec01100 kornec00220 kornec01110
EC Number
EC:2.3.1.35 glutamate N-acetyltransferase; ornithine transacetylase; alpha-N-acetyl-L-ornithine:L-glutamate N-acetyltransferase; acetylglutamate synthetase; acetylglutamate-acetylornithine transacetylase; acetylglutamic synthetase; acetylglutamic-acetylornithine transacetylase; acetylornithine glutamate acetyltransferase; glutamate acetyltransferase; N-acetyl-L-glutamate synthetase; N-acetylglutamate synthase; N-acetylglutamate synthetase; ornithine acetyltransferase; 2-N-acetyl-L-ornithine:L-glutamate N-acetyltransferase; acetylornithinase (ambiguous) kornec01100 kornec00220
EC Number
EC:2.3.1.1 amino-acid N-acetyltransferase; N-acetylglutamate synthase; AGAS; acetylglutamate acetylglutamate synthetase; acetylglutamic synthetase; amino acid acetyltransferase; N-acetyl-L-glutamate synthetase; N-acetylglutamate synthetase kornec01100 kornec00220 kornec01110

Occurs in the following pathway maps:

Pathway Description
kornec00220 Arginine biosynthesis
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites
kornec01210 2-Oxocarboxylic acid metabolism
kornec01230 Biosynthesis of amino acids

Sequences

Nucleotide sequence (GC-content: 56.3 %):

ATGACTAAACACGAAATTAACACCTTAACCACTTTCACTTGGCCCAAGGGTTTTTATGCCGACGGGATACACGCTGGTCTGAAGGAAGAAAAAAAGGACCTGGGCTGGCTATATTCCAAGGTGCCGGCCGCTGCCGCCGGGGTCTACACCACCAACCAGTTCCAAGCCGCCCCGACCAAGCTAACGAAGCAAACCGTCAACTTGGCCCACCAACTCCAAACGGTGGTTATGAACAGCGCTAACGCTAATTCTTGCACCGGGCCCCAGGGCATGGTTAACGCCAAAACAATGCAACACCTAGCAGCCAAGAAGCTGGGCTTAACCGATCAGTTGGTCGGCGTGGCCTCAACTGGGATCATCGGCGAACCACTACCAATGGATAAGATCACAAACGGGATTAGCCAACTCAGCCTAACCAAGTCCGCCGCCGTGACCGAGGCGGTTTTGACCACCGACAAGCACCCCAAGTCGATCAGCGTCCAGTTTGAGTTCAATAACGAACCAGTCACCGTGACCGGCTTTGCCAAGGGGTCGGGAATGATCCACCCCAAGATGGCGACCATGCTAGGCTTTGTGACCACCGACGCTAAGATTGACGGGGTGGCCCTACAGCAGCTGTTAAACCAGCAGGTTGACGAAACCTTCAACCAGATCACGGTTGACGGCGACACCTCCACCAACGACATGGTACTGGTCTTGGCCAACGGGATGGCCCAAACCTCACCAGTAACGGCAGATCCGGCTGGCTACGCCCTCTTTGCCGCCGCCTTCCACCAGGTGCTGAGTTTCTTAGCCAAGTCGATTGCTAAGGATGGCGAAGGGGCGACCAAGTTAGTCGAAGCCGACGTCTTGCACGCCTACAACCACGACGAAGCCCAAATGGTGGCTAAGGCCATTGTCGGCTCTAACCTGGTCAAGGCCGCCATCTTCGGCGAGGACCCGAACTGGGGGCGCCTGATGGGGGCAATTGGACAAACCAAGGCCCACTTGGACACCAACCACGTTGACGTTTGGCTCAACGACCAACCCGTCGTCAAGGACAGTCAGGCCTATCTGATTGACCCACAGGTGGTTGCCAGCCACCTCCACGAAAACCAGGTAAACGTTAAAGTCGACCTCCATAACGGCAAGGCGCTCGGCCAGGCCTGGGGGTGTGACCTGACCTACCAGTACGTCAAGATCAACGCCTCGTACCACAACTAG

Protein sequence:

MTKHEINTLTTFTWPKGFYADGIHAGLKEEKKDLGWLYSKVPAAAAGVYTTNQFQAAPTKLTKQTVNLAHQLQTVVMNSANANSCTGPQGMVNAKTMQHLAAKKLGLTDQLVGVASTGIIGEPLPMDKITNGISQLSLTKSAAVTEAVLTTDKHPKSISVQFEFNNEPVTVTGFAKGSGMIHPKMATMLGFVTTDAKIDGVALQQLLNQQVDETFNQITVDGDTSTNDMVLVLANGMAQTSPVTADPAGYALFAAAFHQVLSFLAKSIAKDGEGATKLVEADVLHAYNHDEAQMVAKAIVGSNLVKAAIFGEDPNWGRLMGAIGQTKAHLDTNHVDVWLNDQPVVKDSQAYLIDPQVVASHLHENQVNVKVDLHNGKALGQAWGCDLTYQYVKINASYHN

GenBank Info

gene - argJ
locus_tag - FAM19471-i1-1.1_000848
EC_number - 2.3.1.1 --AND-- 2.3.1.35
inference - COORDINATES: similar to AA sequence:RefSeq:WP_003685208.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
protein_id - extdb:FAM19471-i1-1.1_000848

Gene locus (click to toggle display options) expand

Located on scaffold FAM19471-i1-1_scf0012

Update range to 10000 bp

FAM19471-i1-1.1_000847
FAM19471-i1-1.1_000849