locus tag: FAM19471-i1-1.1_001114 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Gene Product
 type II toxin-antitoxin system Phd/YefM family antitoxin
KEGG reaction
 R09380 acyl-ACP:sn-glycerol-3-phosphate 1-O-acyltransferase; Acyl-[acyl-carrier protein] + sn-Glycerol 3-phosphate <=> 1-Acyl-sn-glycerol 3-phosphate + Acyl-carrier protein
KEGG reaction
 R00851 acyl-CoA:sn-glycerol-3-phosphate 1-O-acyltransferase; sn-Glycerol 3-phosphate + Acyl-CoA <=> 1-Acyl-sn-glycerol 3-phosphate + CoA kornec01100 kornec00561 kornec00564 kornec01110
Ortholog
 N0.HOG0002383 type II toxin-antitoxin system Phd/YefM family antitoxin
KEGG gene
 K19159 yefM; antitoxin YefM
KEGG gene
 K08591 plsY; acyl phosphate:glycerol-3-phosphate acyltransferase [EC:2.3.1.275] kornec01100 kornec00561 kornec00564 kornec01110
Eggnog Ortholog
 EO:1VEE5
Eggnog Description
 ED:Antitoxin component of a toxin-antitoxin (TA) module
EC Number
 EC:2.3.1.15 glycerol-3-phosphate 1-O-acyltransferase; alpha-glycerophosphate acyltransferase; 3-glycerophosphate acyltransferase; ACP:sn-glycerol-3-phosphate acyltransferase; glycerol 3-phosphate acyltransferase; glycerol phosphate acyltransferase; glycerol phosphate transacylase; glycerophosphate acyltransferase; glycerophosphate transacylase; sn-glycerol 3-phosphate acyltransferase; sn-glycerol-3-phosphate acyltransferase; glycerol-3-phosphate O-acyltransferase (ambiguous) kornec01100 kornec00561 kornec00564 kornec01110

Occurs in the following pathway maps:

Pathway Description
kornec00561 Glycerolipid metabolism
kornec00564 Glycerophospholipid metabolism
kornec01100 Metabolic pathways
kornec01110 Biosynthesis of secondary metabolites

Sequences

Nucleotide sequence (GC-content: 41.2 %):

Download Copy to clipboard
ATGGACCAAATTGTAACCCCAACGCAAGCACGGAAAGATTTATTCAAAATAATCAAAAGGATCAATGAAAATAATGAGCCGGTTGTGATTAAGCCGACCAAGGCGGATGAAAAGAGCGTTGTCGTCATTGGTGAAGATGACTGGAAAGCAATCCAAGAAACGTTATTTTTGGTTAATCACGGTGTTGACAAGCAAATTAAAGAACGGGAAAACGAGCCGCTCGACGACTTTGATGATGTTTGGGGTCAACTATGA

Protein sequence:

Download Copy to clipboard
MDQIVTPTQARKDLFKIIKRINENNEPVVIKPTKADEKSVVVIGEDDWKAIQETLFLVNHGVDKQIKERENEPLDDFDDVWGQL

GenBank Info

locus_tag - FAM19471-i1-1.1_001114
inference - COORDINATES: similar to AA sequence:RefSeq:WP_004562988.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - type II toxin-antitoxin system Phd/YefM family antitoxin
protein_id - extdb:FAM19471-i1-1.1_001114

Gene locus (click to toggle display options) expand

Located on scaffold FAM19471-i1-1_scf0019

Update range to 10000 bp
FAM19471-i1-1.1_001113
FAM19471-i1-1.1_001115