Annotations

Type Name Description Pathways
Gene Product
methylated-DNA--[protein]-cysteine S-methyltransferase
Ortholog
N0.HOG0001088 methylated-DNA--[protein]-cysteine S-methyltransferase
KEGG gene
K01246 tag; DNA-3-methyladenine glycosylase I [EC:3.2.2.20] kornec03410
KEGG gene
K00567 ogt, MGMT; methylated-DNA-[protein]-cysteine S-methyltransferase [EC:2.1.1.63]
Gene Ontology
GO:1901360 organic cyclic compound metabolic process
Gene Ontology
GO:0090304 nucleic acid metabolic process
Gene Ontology
GO:0071704 organic substance metabolic process
Gene Ontology
GO:0051716 cellular response to stimulus
Gene Ontology
GO:0050896 response to stimulus
Gene Ontology
GO:0046483 heterocycle metabolic process
Gene Ontology
GO:0044260 cellular macromolecule metabolic process
Gene Ontology
GO:0044238 primary metabolic process
Gene Ontology
GO:0044237 cellular metabolic process
Gene Ontology
GO:0043412 macromolecule modification
Gene Ontology
GO:0043170 macromolecule metabolic process
Gene Ontology
GO:0035510 DNA dealkylation
Gene Ontology
GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
GO:0033554 cellular response to stress
Gene Ontology
GO:0032259 methylation
Gene Ontology
GO:0016741 transferase activity, transferring one-carbon groups
Gene Ontology
GO:0016740 transferase activity
Gene Ontology
GO:0009987 cellular process
Gene Ontology
GO:0008172 S-methyltransferase activity
Gene Ontology
GO:0008168 methyltransferase activity
Gene Ontology
GO:0008152 metabolic process
Gene Ontology
GO:0008150 biological_process
Gene Ontology
GO:0006974 cellular response to DNA damage stimulus
Gene Ontology
GO:0006950 response to stress
Gene Ontology
GO:0006807 nitrogen compound metabolic process
Gene Ontology
GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
GO:0006307 DNA dealkylation involved in DNA repair
Gene Ontology
GO:0006304 DNA modification
Gene Ontology
GO:0006281 DNA repair
Gene Ontology
GO:0006259 DNA metabolic process
Gene Ontology
GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
GO:0003908 methylated-DNA-[protein]-cysteine S-methyltransferase activity
Gene Ontology
GO:0003824 catalytic activity
Gene Ontology
GO:0003674 molecular_function
Eggnog Protein
EP:ogt
Eggnog Ortholog
EO:1V2MB
Eggnog Description
ED:Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the methylated nucleobase in DNA by stoichiometrically transferring the methyl group to a cysteine residue in the enzyme. This is a suicide reaction the enzyme is irreversibly inactivated
EC Number
EC:3.2.2.20 DNA-3-methyladenine glycosylase I; deoxyribonucleate 3-methyladenine glycosidase I; 3-methyladenine DNA glycosylase I; DNA-3-methyladenine glycosidase I
EC Number
EC:2.1.1.63 methylated-DNA---[protein]-cysteine S-methyltransferase; ada (gene name); ogt (gene name); MGT1 (gene name); MGMT (gene name)

Occurs in the following pathway maps:

Pathway Description
kornec03410 Base excision repair

Sequences

Nucleotide sequence (GC-content: 57.6 %):

ATGCAAACTACCTGCCATTACCAATCCCCTTTAGGTGACATTTTACTGGTCAGCGACGAACAAGGGGTGTGCGGCCTCTGGTTTGAAGACGGCCGCTACTATGCCGATACGGTTGAAGACGACGCCCAAGCGGGAACCAGCCCGGCACTAGACCAGGCCCGCCGCTGGCTTGACGAATATTTTGCCGGCCAAGCCCCGACTTGGCTACCGCCCCTCCACGTTCAGGGAACCCCCTTCCAACGACAGGTTTGGGAACGGTTACTGACGATCCCCTACGGCCACCTGGTAACTTACGGCGAGCTAGCTAAACGGGTGGCGAAGCTTCGCCACCGGACCTCCATGTCTGCCCAGGCGGTCGGCAACGCCGTCGGTAAAAACCACCTCTCCTTGTTCATCCCCTGCCACCGGGTCATCGGGGCGCACGGTAACTTGACCGGTTACGGAGGTGGCTTAGAACGTAAAATCGCCCTACTTGAATTAGAAGGGCATTTGGCAAGTGACTTTTCTTGGCCATCCTAA

Protein sequence:

MQTTCHYQSPLGDILLVSDEQGVCGLWFEDGRYYADTVEDDAQAGTSPALDQARRWLDEYFAGQAPTWLPPLHVQGTPFQRQVWERLLTIPYGHLVTYGELAKRVAKLRHRTSMSAQAVGNAVGKNHLSLFIPCHRVIGAHGNLTGYGGGLERKIALLELEGHLASDFSWPS

GenBank Info

locus_tag - FAM19471-i1-1.1_001102
inference - COORDINATES: similar to AA sequence:RefSeq:WP_015639344.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - methylated-DNA--[protein]-cysteine S-methyltransferase
protein_id - extdb:FAM19471-i1-1.1_001102

Gene locus (click to toggle display options) expand

Located on scaffold FAM19471-i1-1_scf0019

Update range to 10000 bp

FAM19471-i1-1.1_001101
FAM19471-i1-1.1_001103