locus tag: FAM19471-i1-1.1_001082 genome: FAM19471-i1-1.1
species: Limosilactobacillus fermentum taxid: 1613

Annotations

Type Name Description Pathways
Ortholog
 N0.HOG0001021 GtrA family protein
Gene Product
 GtrA family protein
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901363 heterocyclic compound binding
Gene Ontology
 GO:1901362 organic cyclic compound biosynthetic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:1901265 nucleoside phosphate binding
Gene Ontology
 GO:0140101 catalytic activity, acting on a tRNA
Gene Ontology
 GO:0140098 catalytic activity, acting on RNA
Gene Ontology
 GO:0097159 organic cyclic compound binding
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0055114 oxidation-reduction process
Gene Ontology
 GO:0051188 obsolete cofactor biosynthetic process
Gene Ontology
 GO:0051186 obsolete cofactor metabolic process
Gene Ontology
 GO:0050662 obsolete coenzyme binding
Gene Ontology
 GO:0050661 NADP binding
Gene Ontology
 GO:0048037 obsolete cofactor binding
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0046148 pigment biosynthetic process
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0042440 pigment metabolic process
Gene Ontology
 GO:0042168 heme metabolic process
Gene Ontology
 GO:0036094 small molecule binding
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0033014 tetrapyrrole biosynthetic process
Gene Ontology
 GO:0033013 tetrapyrrole metabolic process
Gene Ontology
 GO:0019438 aromatic compound biosynthetic process
Gene Ontology
 GO:0018130 heterocycle biosynthetic process
Gene Ontology
 GO:0016903 oxidoreductase activity, acting on the aldehyde or oxo group of donors
Gene Ontology
 GO:0016749 N-succinyltransferase activity
Gene Ontology
 GO:0016748 succinyltransferase activity
Gene Ontology
 GO:0016747 transferase activity, transferring acyl groups other than amino-acyl groups
Gene Ontology
 GO:0016746 transferase activity, transferring acyl groups
Gene Ontology
 GO:0016740 transferase activity
Gene Ontology
 GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
Gene Ontology
 GO:0016491 oxidoreductase activity
Gene Ontology
 GO:0016410 N-acyltransferase activity
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008883 glutamyl-tRNA reductase activity
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006783 heme biosynthetic process
Gene Ontology
 GO:0006779 porphyrin-containing compound biosynthetic process
Gene Ontology
 GO:0006778 porphyrin-containing compound metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0003870 5-aminolevulinate synthase activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000166 nucleotide binding
Eggnog Protein
 EP:gtcA
Eggnog Ortholog
 EO:1VESW
Eggnog Description
 ED:Teichoic acid glycosylation protein

Sequences

Nucleotide sequence (GC-content: 49.7 %):

Download Copy to clipboard
ATGCGCAAACTCTGGAACAAGTACGGCCAAGTGATCGCCTACCTCTTTTGGGGTGTGGTCACCACCCTGGTCAATATCGTGTCGTTCCAGTTCCTCTCCTCAGGGGTCCACTGGAACTACCAGGTGGCCAATGTAACGGCCTGGTTTTTATCCGTTTTAGTTGCCTACCTCACCAACAAGGTCTGGGTTTTTAACTCCCATTACACCACTTGGAAGGCCTTTTGGATTGAGATCTCCCAGTTCTTCTTTTACCGGGGCCTCACCCTCTTGATCGACATGGCCTTCATGTTCGTAGGGGTGACCTTGTTAAAGCTCAACACCCCAATCCAAGAACTAATGGTGAAGATCGTTGATAACGTGGTGGTCGTGGTCGCCAACTACATCTTCTCGCGGTGGCTGATCTTTAAGGACAACGAAAAAATTGCTAAGCGGTAG

Protein sequence:

Download Copy to clipboard
MRKLWNKYGQVIAYLFWGVVTTLVNIVSFQFLSSGVHWNYQVANVTAWFLSVLVAYLTNKVWVFNSHYTTWKAFWIEISQFFFYRGLTLLIDMAFMFVGVTLLKLNTPIQELMVKIVDNVVVVVANYIFSRWLIFKDNEKIAKR

GenBank Info

locus_tag - FAM19471-i1-1.1_001082
inference - COORDINATES: similar to AA sequence:RefSeq:WP_012391557.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - GtrA family protein
protein_id - extdb:FAM19471-i1-1.1_001082

Gene locus (click to toggle display options) expand

Located on scaffold FAM19471-i1-1_scf0019

Update range to 10000 bp

Cellular location expand

Responsible annotations:
SL-0162: GO:0016020 membrane
SL-0039: GO:0005886 plasma membrane
FAM19471-i1-1.1_001081
FAM19471-i1-1.1_001083