update range to 10000 bp
locus tag: FAM19038-p1-1.1_002669 genome: FAM19038-p1-1.1
species: Acidipropionibacterium thoenii DSM 20276 taxid: 1122998

Annotations

Type Name Description Pathways
Gene Code
 secG
Gene Product
 preprotein translocase subunit SecG
Ortholog
 N0.HOG0003962 preprotein translocase subunit SecG
KEGG gene
 K03075 secG; preprotein translocase subunit SecG kornec02024kornec03060kornec03070
Gene Ontology
 GO:1904680 peptide transmembrane transporter activity
Gene Ontology
 GO:0090150 establishment of protein localization to membrane
Gene Ontology
 GO:0072657 protein localization to membrane
Gene Ontology
 GO:0072599 establishment of protein localization to endoplasmic reticulum
Gene Ontology
 GO:0072594 establishment of protein localization to organelle
Gene Ontology
 GO:0071944 cell periphery
Gene Ontology
 GO:0071840 cellular component organization or biogenesis
Gene Ontology
 GO:0071806 protein transmembrane transport
Gene Ontology
 GO:0071705 nitrogen compound transport
Gene Ontology
 GO:0071702 organic substance transport
Gene Ontology
 GO:0070972 protein localization to endoplasmic reticulum
Gene Ontology
 GO:0070727 cellular macromolecule localization
Gene Ontology
 GO:0065002 intracellular protein transmembrane transport
Gene Ontology
 GO:0061024 membrane organization
Gene Ontology
 GO:0055085 transmembrane transport
Gene Ontology
 GO:0051649 establishment of localization in cell
Gene Ontology
 GO:0051641 cellular localization
Gene Ontology
 GO:0051234 establishment of localization
Gene Ontology
 GO:0051205 protein insertion into membrane
Gene Ontology
 GO:0051179 localization
Gene Ontology
 GO:0046907 intracellular transport
Gene Ontology
 GO:0045184 establishment of protein localization
Gene Ontology
 GO:0045047 protein targeting to ER
Gene Ontology
 GO:0044464 obsolete cell part
Gene Ontology
 GO:0043952 protein transport by the Sec complex
Gene Ontology
 GO:0042887 amide transmembrane transporter activity
Gene Ontology
 GO:0042886 amide transport
Gene Ontology
 GO:0034613 cellular protein localization
Gene Ontology
 GO:0033365 protein localization to organelle
Gene Ontology
 GO:0033036 macromolecule localization
Gene Ontology
 GO:0032991 protein-containing complex
Gene Ontology
 GO:0032978 protein insertion into membrane from inner side
Gene Ontology
 GO:0031522 cell envelope Sec protein transport complex
Gene Ontology
 GO:0022884 macromolecule transmembrane transporter activity
Gene Ontology
 GO:0022857 transmembrane transporter activity
Gene Ontology
 GO:0016043 cellular component organization
Gene Ontology
 GO:0016020 membrane
Gene Ontology
 GO:0015833 peptide transport
Gene Ontology
 GO:0015031 protein transport
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0008565 obsolete protein transporter activity
Gene Ontology
 GO:0008320 protein transmembrane transporter activity
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0008104 protein localization
Gene Ontology
 GO:0006886 intracellular protein transport
Gene Ontology
 GO:0006810 transport
Gene Ontology
 GO:0006616 SRP-dependent cotranslational protein targeting to membrane, translocation
Gene Ontology
 GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Gene Ontology
 GO:0006613 cotranslational protein targeting to membrane
Gene Ontology
 GO:0006612 protein targeting to membrane
Gene Ontology
 GO:0006605 protein targeting
Gene Ontology
 GO:0005886 plasma membrane
Gene Ontology
 GO:0005623 obsolete cell
Gene Ontology
 GO:0005575 cellular_component
Gene Ontology
 GO:0005215 transporter activity
Gene Ontology
 GO:0003674 molecular_function
Eggnog Protein
 EP:secG
Eggnog Ortholog
 EO:2GR31
Eggnog Description
 ED:Preprotein translocase SecG subunit

Occurs in the following pathway maps:

Pathway Description
kornec02024 Quorum sensing
kornec03060 Protein export
kornec03070 Bacterial secretion system

Sequences

Nucleotide sequence (GC-content: 61.7 %):

Download Copy to clipboard
ATGACATGGCCCGTGATGACCTTGTCGATCATCCTGTGCGTGTTCAGCGTGATCCTGACCCTGTTTGTGCTGCTGCACAAGAGCAAGGGTGGCGGCCTGTCCGACCTGTTCGGTGGGGGAGTGTCCACCTCGATGGGCGGCACCTCGGTGGCGGAACGCAATCTAGACCGGCTGACGGTGATCATGGGCCTGCTGTGGCTGGCCTGCATCATCGGCCTGCTGTTCGTGTACCGGTACGCCTGA

Protein sequence:

Download Copy to clipboard
MTWPVMTLSIILCVFSVILTLFVLLHKSKGGGLSDLFGGGVSTSMGGTSVAERNLDRLTVIMGLLWLACIIGLLFVYRYA

GenBank Info

gene - secG
locus_tag - FAM19038-p1-1.1_002669
inference - COORDINATES: similar to AA sequence:RefSeq:WP_016667361.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - preprotein translocase subunit SecG
protein_id - extdb:FAM19038-p1-1.1_002669

Gene Locus

Located on scaffold FAM19038-p1-1_scf0001

Cellular location expand

Responsible annotations:
SL-0162: GO:0016020 membrane
SL-0039: GO:0005886 plasma membrane
FAM19038-p1-1.1_002668
FAM19038-p1-1.1_002670