locus tag: FAM19038-p1-1.1_002556 genome: FAM19038-p1-1.1
species: Acidipropionibacterium thoenii DSM 20276 taxid: 1122998

Annotations

Type Name Description Pathways
Gene Code
 ybeY
Gene Product
 rRNA maturation RNase YbeY
KEGG reaction
 R08221 5'-deoxy-5-fluorocytidine aminohydrolase; 5'-Deoxy-5-fluorocytidine + H2O <=> 5'-Deoxy-5-fluorouridine + Ammonia kornec00983
KEGG reaction
 R05838 pyridoxine 5'-phosphate synthase; 3-Amino-2-oxopropyl phosphate + 1-Deoxy-D-xylulose 5-phosphate <=> Pyridoxine phosphate + Orthophosphate + 2 H2O kornec01100 kornec01240 kornec00750
KEGG reaction
 R02485 deoxycytidine aminohydrolase; Deoxycytidine + H2O <=> Deoxyuridine + Ammonia kornec01100 kornec00240
KEGG reaction
 R01878 Cytidine aminohydrolase; Cytidine + H2O <=> Uridine + Ammonia kornec01100 kornec00240
Ortholog
 N0.HOG0000845 rRNA maturation RNase YbeY
KEGG gene
 K07042 ybeY, yqfG; probable rRNA maturation factor
KEGG gene
 K03595 era, ERAL1; GTPase
KEGG gene
 K03474 pdxJ; pyridoxine 5-phosphate synthase [EC:2.6.99.2] kornec01100 kornec01240 kornec00750
KEGG gene
 K01489 cdd, CDA; cytidine deaminase [EC:3.5.4.5] kornec01100 kornec00983 kornec00240
Gene Ontology
 GO:2001141 regulation of RNA biosynthetic process
Gene Ontology
 GO:2000112 regulation of cellular macromolecule biosynthetic process
Gene Ontology
 GO:1903506 regulation of nucleic acid-templated transcription
Gene Ontology
 GO:1901576 organic substance biosynthetic process
Gene Ontology
 GO:1901566 organonitrogen compound biosynthetic process
Gene Ontology
 GO:1901564 organonitrogen compound metabolic process
Gene Ontology
 GO:1901360 organic cyclic compound metabolic process
Gene Ontology
 GO:0140098 catalytic activity, acting on RNA
Gene Ontology
 GO:0090502 RNA phosphodiester bond hydrolysis, endonucleolytic
Gene Ontology
 GO:0090501 RNA phosphodiester bond hydrolysis
Gene Ontology
 GO:0090305 nucleic acid phosphodiester bond hydrolysis
Gene Ontology
 GO:0090304 nucleic acid metabolic process
Gene Ontology
 GO:0080090 regulation of primary metabolic process
Gene Ontology
 GO:0071840 cellular component organization or biogenesis
Gene Ontology
 GO:0071704 organic substance metabolic process
Gene Ontology
 GO:0065007 biological regulation
Gene Ontology
 GO:0060255 regulation of macromolecule metabolic process
Gene Ontology
 GO:0051252 regulation of RNA metabolic process
Gene Ontology
 GO:0051171 regulation of nitrogen compound metabolic process
Gene Ontology
 GO:0051128 regulation of cellular component organization
Gene Ontology
 GO:0050896 response to stimulus
Gene Ontology
 GO:0050794 regulation of cellular process
Gene Ontology
 GO:0050789 regulation of biological process
Gene Ontology
 GO:0046914 transition metal ion binding
Gene Ontology
 GO:0046872 metal ion binding
Gene Ontology
 GO:0046483 heterocycle metabolic process
Gene Ontology
 GO:0044271 cellular nitrogen compound biosynthetic process
Gene Ontology
 GO:0044267 cellular protein metabolic process
Gene Ontology
 GO:0044260 cellular macromolecule metabolic process
Gene Ontology
 GO:0044249 cellular biosynthetic process
Gene Ontology
 GO:0044238 primary metabolic process
Gene Ontology
 GO:0044237 cellular metabolic process
Gene Ontology
 GO:0044085 cellular component biogenesis
Gene Ontology
 GO:0043604 amide biosynthetic process
Gene Ontology
 GO:0043603 cellular amide metabolic process
Gene Ontology
 GO:0043244 regulation of protein-containing complex disassembly
Gene Ontology
 GO:0043170 macromolecule metabolic process
Gene Ontology
 GO:0043169 cation binding
Gene Ontology
 GO:0043167 ion binding
Gene Ontology
 GO:0043043 peptide biosynthetic process
Gene Ontology
 GO:0042274 ribosomal small subunit biogenesis
Gene Ontology
 GO:0042254 ribosome biogenesis
Gene Ontology
 GO:0034660 ncRNA metabolic process
Gene Ontology
 GO:0034645 cellular macromolecule biosynthetic process
Gene Ontology
 GO:0034641 cellular nitrogen compound metabolic process
Gene Ontology
 GO:0034470 ncRNA processing
Gene Ontology
 GO:0031564 transcription antitermination
Gene Ontology
 GO:0031554 regulation of DNA-templated transcription, termination
Gene Ontology
 GO:0031326 regulation of cellular biosynthetic process
Gene Ontology
 GO:0031323 regulation of cellular metabolic process
Gene Ontology
 GO:0030490 maturation of SSU-rRNA
Gene Ontology
 GO:0022613 ribonucleoprotein complex biogenesis
Gene Ontology
 GO:0019538 protein metabolic process
Gene Ontology
 GO:0019222 regulation of metabolic process
Gene Ontology
 GO:0019219 regulation of nucleobase-containing compound metabolic process
Gene Ontology
 GO:0016894 endonuclease activity, active with either ribo- or deoxyribonucleic acids and producing 3'-phosphomonoesters
Gene Ontology
 GO:0016892 endoribonuclease activity, producing 3'-phosphomonoesters
Gene Ontology
 GO:0016788 hydrolase activity, acting on ester bonds
Gene Ontology
 GO:0016787 hydrolase activity
Gene Ontology
 GO:0016151 nickel cation binding
Gene Ontology
 GO:0016072 rRNA metabolic process
Gene Ontology
 GO:0016070 RNA metabolic process
Gene Ontology
 GO:0010556 regulation of macromolecule biosynthetic process
Gene Ontology
 GO:0010468 regulation of gene expression
Gene Ontology
 GO:0010467 gene expression
Gene Ontology
 GO:0009987 cellular process
Gene Ontology
 GO:0009889 regulation of biosynthetic process
Gene Ontology
 GO:0009628 response to abiotic stimulus
Gene Ontology
 GO:0009408 response to heat
Gene Ontology
 GO:0009266 response to temperature stimulus
Gene Ontology
 GO:0009059 macromolecule biosynthetic process
Gene Ontology
 GO:0009058 biosynthetic process
Gene Ontology
 GO:0008152 metabolic process
Gene Ontology
 GO:0008150 biological_process
Gene Ontology
 GO:0006950 response to stress
Gene Ontology
 GO:0006807 nitrogen compound metabolic process
Gene Ontology
 GO:0006725 cellular aromatic compound metabolic process
Gene Ontology
 GO:0006518 peptide metabolic process
Gene Ontology
 GO:0006412 translation
Gene Ontology
 GO:0006396 RNA processing
Gene Ontology
 GO:0006364 rRNA processing
Gene Ontology
 GO:0006355 regulation of transcription, DNA-templated
Gene Ontology
 GO:0006139 nucleobase-containing compound metabolic process
Gene Ontology
 GO:0005488 binding
Gene Ontology
 GO:0004540 ribonuclease activity
Gene Ontology
 GO:0004521 endoribonuclease activity
Gene Ontology
 GO:0004519 endonuclease activity
Gene Ontology
 GO:0004518 nuclease activity
Gene Ontology
 GO:0003824 catalytic activity
Gene Ontology
 GO:0003674 molecular_function
Gene Ontology
 GO:0000478 endonucleolytic cleavage involved in rRNA processing
Gene Ontology
 GO:0000469 cleavage involved in rRNA processing
Eggnog Protein
 EP:ybeY
Eggnog Ortholog
 EO:2GMUF
Eggnog Description
 ED:Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA
EC Number
 EC:3.5.4.5 cytidine deaminase; cytosine nucleoside deaminase; (deoxy)cytidine deaminase; cdd (gene name); CDA (gene name) kornec01100 kornec00983 kornec00240
EC Number
 EC:2.6.99.2 pyridoxine 5'-phosphate synthase; pyridoxine 5-phosphate phospho lyase; PNP synthase; PdxJ kornec01100 kornec00750

Occurs in the following pathway maps:

Pathway Description
kornec00240 Pyrimidine metabolism
kornec00750 Vitamin B6 metabolism
kornec00983 Drug metabolism - other enzymes
kornec01100 Metabolic pathways
kornec01240 Biosynthesis of cofactors

Sequences

Nucleotide sequence (GC-content: 68.2 %):

Download Copy to clipboard
ATGATCGATATCAACAACGAGTCGGGGCAGGACGCCGACGAGCGGGGCCTGGTCGCCCTGGCGGGGTTCGCGATGGCCCGGCTGCGCATCCACCCGGAGGCCGAGCTGTCGATCCTGCTGGTCGACGAGGCGACCATGGAGGGCTACCACGAGAAGTTCATGGGCCTGCCCGGGCCCACCGATGTGCTGAGCTTCCCGATGGACGAGCTGCGCTCCCCCTCCGACGGGGAGGCCGAGCCGAACGGGATCCTCGGCGACATCGTGCTGTGCCCCACGGTCACCGCCCGGCAGGCCGGCGAGAACGGCCGCACTCCCGACGGCGAGGCCGAGTACCTGCTCATCCACGGACTGCTCCACCTGCTCGGCCACGATCACGCCGAGCCGGAGGAGAAGAAGGTGATGTTCGGCCTCAACGACGAGATCATCAACGCCTGGGAGATGGCCCGCAACGGGAATCAGGCCCGATGA

Protein sequence:

Download Copy to clipboard
MIDINNESGQDADERGLVALAGFAMARLRIHPEAELSILLVDEATMEGYHEKFMGLPGPTDVLSFPMDELRSPSDGEAEPNGILGDIVLCPTVTARQAGENGRTPDGEAEYLLIHGLLHLLGHDHAEPEEKKVMFGLNDEIINAWEMARNGNQAR

GenBank Info

gene - ybeY
locus_tag - FAM19038-p1-1.1_002556
inference - COORDINATES: similar to AA sequence:RefSeq:WP_014846738.1
note - Derived by automated computational analysis using gene prediction method: Protein Homology.
codon_start - 1
transl_table - 11
product - rRNA maturation RNase YbeY
protein_id - extdb:FAM19038-p1-1.1_002556

Gene locus (click to toggle display options) expand

Located on scaffold FAM19038-p1-1_scf0001

Update range to 10000 bp
FAM19038-p1-1.1_002555
FAM19038-p1-1.1_002557